DPCstruct | MC40773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 129 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7P0TA53 | 2-127 | DTFSTVISSSIQLLVQDLDAACDPALTAMSKMQWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCVKFANSFIPKF… |
| A0A6J1WM47 | 2-118 | ITNCIQMLVQDLEVACEPALQAMTKISWLHFDTVGDQSSYVTQIIMHLKNTVPHLRDNLSSSRKYFTQFCIRFANSFIPKFIQNIYK… |
| A0A183WDB8 | 8-139 | None |
| A0A453G2V6 | 237-369 | None |
| A0A1I8IEJ1 | 3-122 | None |
| A0A2B4S503 | 19-165 | None |
| A0A2U1QL24 | 101-240 | None |
| A0A163KSK9 | 851-969 | None |
| T1H365 | 51-196 | None |
| A0A2N5V2S7 | 187-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.