DPCstruct | MC4077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5JK73 | 59-133 | HGGRCVRDNTNGEPGCKSKEEIDQRFWRHNFDPTRYWECTRLNEPAELRTCQDQAFHPSQLECVDWDSWEWEPVC |
| A0A336LYR8 | 10-91 | LIVAVNACVPDDTDGRPLCNDETTLVGQNYRNNFDPNLYWNCASLNNAVSVKCPTEAPLYYVVQDKCVTSGVWRWTPPCKPD |
| A0A182TB50 | 1-75 | None |
| B4JEE0 | 28-113 | None |
| A0A6P5UGK9 | 2-81 | None |
| A0A1I8NAE0 | 21-89 | None |
| T1GQB1 | 1-101 | None |
| Q171K1 | 21-84 | None |
| A0A6P4EQV4 | 78-158 | None |
| B3M3C4 | 2-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.