DPCstruct | MC40768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1WFW8 | 1-99 | MLTIGGAAGHIVIATLKNASSTAEVKTMSANIVSDRDGFVWKGHDQLTLRSGPLTFPQGYQATSVAQVSPPAAVTALAAQWEWGVVA… |
| A0A0S7FGR5 | 42-138 | SVAGTAGQILMLELNDEEAEQTVEAKVVDLLQGQEGFRWKGHTPLDVREEPVLFPPGFQPFTVVQCQPPAVVTALNLHSEWKLVAFG… |
| A0A0B1SQL4 | 235-344 | None |
| A0A085LK69 | 182-292 | None |
| A0A0S7FMD1 | 1-87 | None |
| A0A834DVV5 | 1-102 | None |
| A0A833RZ59 | 341-424 | None |
| A0A6F9CN76 | 1-99 | None |
| S4RD29 | 149-271 | None |
| A0A482XQK3 | 177-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.