DPCstruct | MC4076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 172 ± 24 aa |
| Standard deviation of domain lengths | 23.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8ZW36 | 118-260 | EEDLSDKEIKRKKKGRNTLLLRQSKDQSLTPAKSFDSKPRLKIPAKERKSKKDIAVSKLPNEFSSGSFVVIKSDFHSTTTPAIWKID… |
| A0A336LUX9 | 1-197 | MFLGFSVHRLYEDQKKGKGKGKKKTRSEYDSEEYSADDTGAASAKKGGSGGAKNFPDKQGFLSLYIFRGDLVNGIRANENLCLWRRD… |
| A0A0M4EQ17 | 67-250 | None |
| A0A0K0E1Z5 | 892-1067 | None |
| A0A821X0Z3 | 1-153 | None |
| A0A0N4WJI1 | 1-158 | None |
| A0A6P7FG55 | 66-224 | None |
| A0A835GC53 | 77-217 | None |
| A0A1I7YW57 | 5-209 | None |
| A0A3L8D3J2 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.