DPCstruct | MC40759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 174 ± 33 aa |
| Standard deviation of domain lengths | 33.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.15 |
| Pfam Score | 94.68 |
| Assigned Pfam label(s) | CL0634- PF01627- CL0025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6NFL1 | 1-195 | MSMDISAFYQTFFDEAAELLADMEQHLLILDPENPDSEQLNAIFRAAHSIKGGAGTFGFTVLQETTHLLENLLDEARRGEMALSTAI… |
| A0A2X2DH19 | 2-118 | KADELLADMEQHLLLLDPQNPDQEQLNAIFRSAHSIKGGAATFGFVKLQQTTHVLENLLDSARRHEMVLTDDIINLFLEAKDIMQQQ… |
| N6VYP0 | 1-179 | None |
| A0A2T6CKK7 | 206-375 | None |
| A0A536VXV4 | 681-871 | None |
| A0A7J0BJ14 | 4-244 | None |
| A0A520D2G1 | 2-148 | None |
| A0A4Q6G8E8 | 4-184 | None |
| A0A2X2S420 | 9-201 | None |
| A0A2G6EKA8 | 9-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.