DPCstruct | MC40757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6Z3Y0 | 2-132 | QYTSSGIDLSCDFTETDIIDIGDADENVTWWWYAILAQYEGWKAIVKQAAHREFLAPWTVSRMCETRFAINKGLSPTSSYTPLSAEK… |
| Q0CLB3 | 1-117 | MAHWCGTDGPASSSLFELPLGHVEPAEARWWAAILAAGSGWRATLYRDGKEYSAPWSCHLAKHSFILGLGTGMSSSAFQSCKPPSSA… |
| C1H8N1 | 178-328 | None |
| A0A428PR76 | 31-171 | None |
| A0A0A5IE20 | 313-423 | None |
| A0A559L2X1 | 4-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.