DPCstruct | MC40756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 22.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0374- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3D4D3 | 28-237 | LSPYISNTINLPPINDMDGLIIAFITRRHTVVPLAAKLTPEQAAAVFMIGESIETSAGDPKRAGESIREVGTNPFIIGDKSYEGNWF… |
| G1RYX0 | 371-572 | PAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRK… |
| A0A6A5L4P8 | 204-372 | None |
| A0A0M3IGI4 | 1-163 | None |
| A0A452T4U6 | 209-385 | None |
| A0A1Q9CBJ7 | 410-597 | None |
| A0A2C9K0Q4 | 220-377 | None |
| A0A7J6Q202 | 2-162 | None |
| A0A7V0SSF1 | 2-161 | None |
| D0N417 | 74-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.