DPCstruct | MC40755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.74 |
| Pfam Score | 86.35 |
| Assigned Pfam label(s) | PF21018- CL0167- CL0437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5L3A1 | 131-245 | KSSENVGQRIGSVMVSNGTGKALNHALAHLRDRGRMMITHGEQVYKGQIIGAAITPSDLYVNCRQGKQLARVWRTTADKNYAMKATF… |
| A0A7V0P5G5 | 11-127 | EYGPFAGEIRNRNKGAMVVKESCTTVAYALFNLQDRGKLFCDPGTRVYRGQIIGEHCRPQDLVVNPAKGKKLTNMRASGSDENVILT… |
| A0A381IBH0 | 27-170 | None |
| A0A813AJN3 | 786-929 | None |
| A0A1R3IK62 | 193-330 | None |
| A0A7S0LZK5 | 60-199 | None |
| A0A1Q9CA85 | 1052-1173 | None |
| A0A6A6L4H8 | 1-83 | None |
| A0A855HLT7 | 1-85 | None |
| U6LRQ7 | 68-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.