DPCstruct | MC40749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Standard deviation of domain lengths | 16.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7VLA4 | 2-83 | KKGPIKSKEITCAFCKGKGIDPFGIPSKMSSCQVCWGKGKVAIADIPHETCSACKGTGIFEHHRLPCSVCKGKGMVPKDRRE |
| A0A7X4KNT3 | 6-75 | FKPVECPLCEGTGEHNEEPCPYCGGEREVSSAYAVQFDKRMYELVQCPVCKGRGYNGDADCGPCEGSGEV |
| A0A7S0CKH5 | 22-135 | None |
| A0A7W0EQ10 | 5-107 | None |
| A0A0S7XJW6 | 1-106 | None |
| J0S1B9 | 125-200 | None |
| A0A660V448 | 491-579 | None |
| A0A1E3XD42 | 74-143 | None |
| A0A1E3XHB3 | 26-144 | None |
| A0A822IYW5 | 15-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.