DPCstruct | MC40748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820N0L8 | 3-124 | LKCKFEFFITRLMELIVSEQSKISYEQKEIALETIVQLLRIPGLPAELYLNYDCDLYSTNLFEELTKMLSKNAFPVAGLTSTHILSL… |
| A0A314YDS0 | 403-519 | SMVCSIVLNLYHHLRTELKLQLEAFFSCVILRLAQSRYGASYQQQEVAMEAVVDFCRQKTFMVEMYANLDCDITCSNAFEDLANLLS… |
| A0A183W8L8 | 143-245 | None |
| A0A6I9PMH4 | 285-410 | None |
| A0A7R9FV00 | 646-755 | None |
| A0A183MZK8 | 308-421 | None |
| A1Z8W8 | 438-566 | None |
| A0A0B2V902 | 544-648 | None |
| A0A7J7L0L4 | 233-324 | None |
| A0A6A6MPA9 | 101-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.