DPCstruct | MC40746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.93 |
| Pfam Score | 87.82 |
| Assigned Pfam label(s) | CL0073- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820N047 | 1-152 | LFISDSDKRKYINLNIKLFSTNNYHPNSYIGLFESRKIKVISKPSKKKQSVKNAESVCIQSGTKIALFNRLRSQNVSTRFLHVDETN… |
| A0A2H1C912 | 18-153 | LFISDSDKRKYFMLNLKMFYPNGKDLGQFHSRRIKVISKPSKKKQSLKNTDLCIASGTKVALFNRLRSQTVSTRYLHVEDASFHASS… |
| A0A2G8L5X2 | 121-250 | None |
| A0A1I8F7W9 | 248-349 | None |
| A0A6F9D0J1 | 274-388 | None |
| A0A814AHN2 | 331-465 | None |
| A0A060X3S7 | 18-153 | None |
| A0A177B0L4 | 256-386 | None |
| A0A0R3QI59 | 11-151 | None |
| F4RB35 | 100-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.