DPCstruct | MC40743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 22.39 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820MJX3 | 2-101 | KDTDHFENINSTNWQSMRFKPPPVNSNIGWRVEFRPTELQMTDFENAAFVTFIVLLTRAIMTYNLNLLIPISNVDENMQVAQQRDAF… |
| A0A0G4ER78 | 406-520 | TAHFENIQSTNWNSVRFKPPPPSPDGTSPSQIGWRVEFRTPEAQLTDFENAAVAAVVAVLARVIIDEKWDLYIPMSKNDENMARSSQ… |
| A0A812BKJ1 | 26-141 | None |
| W9XZS8 | 211-316 | None |
| A0A1E3PCG0 | 1005-1117 | None |
| A0A5N5PSK9 | 376-526 | None |
| A0A3P7MHY9 | 110-224 | None |
| A0A7S0L9D2 | 7-109 | None |
| A0A2I0T859 | 29-130 | None |
| A0A6P8IS35 | 376-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.