DPCstruct | MC4074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 30.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336LHB7 | 2-155 | DRTWELYEPNEYIYLAKKVAFAIFGLPHDDNIDERGLEGYEPKQREIANKIKDKIVELKPVDNDLHVAFLFVCCKFEEDREFPEPVF… |
| A0A815E505 | 327-504 | LQQWKEKAIKMQDAHVKDNNRTEWFAYNFEHRDALELRILVALHGVRMPAESSKAAPSCPTKTYSREERLEARKIKKVITRHCDTPE… |
| A0A6L5D446 | 25-203 | None |
| A0A2J7RLL2 | 10-194 | None |
| A0A834N1B5 | 61-294 | None |
| A0A3M0MBF4 | 296-463 | None |
| A0A7R9I1P1 | 282-487 | None |
| A0A1A9WU08 | 490-658 | None |
| A0A1S4FEV4 | 12-197 | None |
| A0A6L5DJS6 | 24-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.