DPCstruct | MC40739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 52.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3Z8E6 | 69-158 | NKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLH… |
| A0A3P9QG52 | 933-1022 | NKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFAFLLH… |
| A0A2H2JDL8 | 1-92 | None |
| A0A0R4IRZ9 | 1594-1699 | None |
| A9UUN0 | 2-97 | None |
| A0A0S7EUH9 | 650-738 | None |
| A0A0S7JZN5 | 198-285 | None |
| A0A4Z2B526 | 577-664 | None |
| A0A7R9CJ50 | 198-306 | None |
| A0A3Q3XAS0 | 106-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.