DPCstruct | MC40733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820KLD7 | 1-105 | CTCDQYGSLDVQCDIVSGQCPCKENFMGQRCDLCEENKYRDGFECPNCPSCYREVQKRVDRYRRDLNVLQNAISTLNSSQTLNSLRE… |
| A0A3P8JDQ4 | 181-312 | YGDPTSMIACQPCDCDMDGSRSETCSQETGQCDCWPGIKGRRCGQCEEDHVVDRGTCRADSVKAHIDGLNITSLAHRGLARLRQQVE… |
| A0A183RJ54 | 1-134 | None |
| A0A6V7X7T9 | 972-1102 | None |
| T1GT87 | 75-204 | None |
| A0A3Q3AII8 | 163-289 | None |
| A0A0R3QB30 | 4-135 | None |
| A0A183P1S6 | 271-396 | None |
| A0A672FF51 | 499-614 | None |
| A0A1S3JQ23 | 392-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.