DPCstruct | MC4073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 230 ± 34 aa |
| Standard deviation of domain lengths | 34.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 94.70 |
| Assigned Pfam label(s) | CL0229- PF15927- PF15393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8L0G8 | 2-169 | SAIEDARLKAEQEEKDRLERERLERRRSERIEAAESQRYTAESQDLLSLLEGNRNALVTLLEDRKQKAQWLRFMKCDGSPDPTVNAE… |
| A0A336LE85 | 22-245 | QKNEENERLLEQENQRALQLQKEREHVIRGSMLNETMKQFEKIKSFMEVSRRQEIEEKQWQKYINCKTFPDPKSPPELRSFLFQCEL… |
| A0A6H5GUP5 | 3-265 | None |
| A0A1A9XZE2 | 28-239 | None |
| A0A6P4ELQ9 | 21-200 | None |
| A0A6A4K4I7 | 10-224 | None |
| A0A7S3G521 | 2-220 | None |
| A0A7S3G759 | 17-255 | None |
| A0A6F9CBI3 | 3-229 | None |
| A0A812AN40 | 5-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.