DPCstruct | MC40728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818H0R0 | 9-115 | LFLFGLHSVQCTASNSLANCNMVAAKSNSTCNEVVVTSITATTGIAVICTFGFTASTCPDNYFYGTCMFVHKLCVTCSGSSTVRIRV… |
| A0A814PC01 | 2-103 | ANNSLSDCQRVASAFRSTINYTAANITTTTGINVTCPATGIVCPGQNITGGCIWQRKLSAICRNASGIIKIRIQTNGLPPRCANVPM… |
| A0A821JLJ2 | 11-121 | None |
| A0A819XAW9 | 9-156 | None |
| A0A815YWU8 | 116-250 | None |
| A0A818DIG3 | 6-122 | None |
| A0A818CLV2 | 2-111 | None |
| A0A813UVZ5 | 302-457 | None |
| A0A814PZR7 | 2-124 | None |
| A0A7S1G3J0 | 210-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.