DPCstruct | MC40723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 181 ± 41 aa |
| Standard deviation of domain lengths | 40.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535VQR2 | 10-190 | GTLVCTAASGSRDLTLFQVRTYQAVLMLTWIRFDAPLPWTNLTLDVWFAHAIHGIESRSDAQYSFCCLPGGVIAIQTNNLAVLDKSL… |
| A0A351I5U5 | 98-289 | YEFDRNVPADIQKRMRDDLAFMQGISGWQATPLHQQIFGMVNGPAYFKFFSDRVTGIGMNNCGSANAVACVIPYLNPSKMWLTKNFI… |
| A0A7T9CKI5 | 32-299 | None |
| A0A2N9NEA2 | 24-194 | None |
| A0A4Q7FSJ5 | 24-159 | None |
| A0A1F3SV29 | 141-359 | None |
| A0A8B3CMN7 | 14-189 | None |
| A0A1F8P672 | 2-198 | None |
| A0A6B1E1K3 | 114-249 | None |
| A0A6B1E7W4 | 209-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.