DPCstruct | MC40720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 280 ± 58 aa |
| Standard deviation of domain lengths | 57.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080M081 | 75-298 | KRFVDETTTPEKPRAQNRNAVVLAVPSKDGMDVAREKVRDLLGWEKVREMLKERSDIDTAATTRLEGNLRVARGEMVSQIVMAYSMA… |
| A0A011NVP1 | 75-318 | LADYQVAKLQELHERSKQELALAVQQCFRHIFYPSRNRLDGANCDLAHTVVDIQTASDRPGDGQRQVVTQLQNAGKLRLPTDKPDSP… |
| A0A2V7X8R7 | 63-399 | None |
| A0A1V5XU74 | 131-359 | None |
| A0A7V4Q5F8 | 1-256 | None |
| A0A2C6MGB5 | 124-395 | None |
| A0A7U7GBF7 | 228-476 | None |
| A0A524MT11 | 6-280 | None |
| A0A7C1J700 | 709-1031 | None |
| A0A7V6RME4 | 3-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.