DPCstruct | MC40716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 165 ± 37 aa |
| Standard deviation of domain lengths | 36.54 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 67.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 93.29 |
| Assigned Pfam label(s) | PF12090- PF12056- PF08059- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6CEW7 | 26-196 | RDLQLALAELYEDEVKCKSSKPDRPDVTVFKSPRTPPQRFCSREREYSGLHIVRPSTGKIVNELFKEAREHGAVPLNEATRASGDDK… |
| A2FFG9 | 72-190 | ITKFLADYDLHWVGGPGPKDKTYEHGPDDMNAFQAKIDQLNRSALNTKTHLKQDNNIRRIEFEKPVVITLYNSDFTVGDSPQRPYDL… |
| A0A061QGW7 | 11-160 | None |
| A0A1X2I350 | 50-250 | None |
| A0A1Y1UXU4 | 260-480 | None |
| A0A094GRT1 | 81-270 | None |
| A0A5K1U6D6 | 25-213 | None |
| A0A7N0TAY6 | 122-267 | None |
| A0A5K4F712 | 36-145 | None |
| A0A7S1SPB4 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.