DPCstruct | MC40715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF05507- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286XBG8 | 5-91 | LMKRTKFLYQFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNQAGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCA |
| A0A6P6C7A0 | 11-103 | PLVNKQTFLHNFSHLNYLHETYLCYEVDRMQDDLWIPLDEYKGFLRNKSSPWRWERRHAEPIFLERMASWNLDTELRYRVTVFISWS… |
| G1PBV8 | 137-230 | None |
| M7CFL1 | 153-239 | None |
| H0Y0C6 | 3-89 | None |
| L5K8J0 | 251-340 | None |
| I3N301 | 1-98 | None |
| A0A834AXJ1 | 83-172 | None |
| A0A7J7FJ58 | 114-205 | None |
| A0A1S3MIQ7 | 108-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.