DPCstruct | MC40714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 360 ± 42 aa |
| Standard deviation of domain lengths | 42.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | PF15695- PF13804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q07DS3 | 1-329 | MVTPVTWMDNPIEVYVNDSEWVPGPTDDRCPAKPEEEGMMINISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVS… |
| A0A6P6C6D9 | 1-397 | MQNHRYGYQIGSSGLHHKRRFPPLAHSTPDPGSPDTPDSLTPKMAKINLSSPQQAHSTKKALFPTWGQIKKLTSEAETLVSAGGHQP… |
| W5PPK0 | 2-313 | None |
| A0A286XB25 | 1-350 | None |
| P63135 | 857-1169 | None |
| A0A5F7ZN25 | 1-305 | None |
| A0A4W2FWD0 | 158-573 | None |
| A0A673URD3 | 63-472 | None |
| A0A5F8AET4 | 7-362 | None |
| A0A5F7Z9G6 | 1-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.