DPCstruct | MC40711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 421 ± 118 aa |
| Standard deviation of domain lengths | 117.98 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.77 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF10211- PF15739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BWP9 | 12-418 | ELNTMKANFGDVVPRRDFEMQEKTNKDLQEQLDSLRDDYKEVCKEHEMLLQLHMSTLKERDQYHSELQEIQRTSTPRPDWAKCEDVV… |
| A0A7S1NPA1 | 16-300 | NFVMGLGTGSAVPKYLRWHGKLNRRYIRKADLEQIIKDFWKYKQAADAKSGKRSGVQDTMYHFLKMRYGVQGAIAEHGYGIRDACLQ… |
| A0A2G9SBL4 | 62-342 | None |
| A0A3F2RNW6 | 155-564 | None |
| A2FHJ1 | 141-647 | None |
| A0A7S4M4R4 | 8-313 | None |
| A0A3R7CVY8 | 50-336 | None |
| A0A7S1GQ72 | 25-299 | None |
| A0A5B8MFD5 | 91-575 | None |
| A0A7S3G9G2 | 226-789 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.