DPCstruct | MC40710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BVR7 | 1-129 | MALRSRCRELLSICRNPGCGVAVFSTSSKPEVKPEVDPLENEAIAPEFINRNPRNLELLALARKERGWGTVWPSREFWHRLRVIRTQ… |
| A0A812BF42 | 23-132 | RFIPQIERQVACLSTTACCMSDEKKGTNHNYIVNPMFYNRNPRSLEFMGLARKQKGWRFQAPRNDYYHKLVFEKTNWNIHAYIVHSS… |
| B7P265 | 1-111 | None |
| A0A814EM17 | 294-409 | None |
| A0A498N008 | 305-408 | None |
| T1EFH5 | 21-130 | None |
| A0A7R9MFI7 | 37-161 | None |
| A0A6I8N097 | 173-287 | None |
| A0A815E348 | 11-94 | None |
| C1L8A4 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.