DPCstruct | MC4070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 246 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 17.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8F3A2 | 27-146 | KKKCVSCATEKTCRWRRSKLLSRATLCDKCYRNEALALTSRQCYVCESKQTTGQWFKSKVDLSFDLCRNCWVKEHALLANKVCINCK… |
| A0A820Z9R8 | 9-110 | KNFPSKKKPSQAEGRECVNCGAKATPLWRRDGNGNYLCNACGLYHKMNGHNRPLIKPKRRLSTVKKTGVYCSNCNTSTTTLWRRNGR… |
| A0A6V7W6C5 | 109-213 | None |
| A0A820TAE6 | 595-695 | None |
| C5DV50 | 82-182 | None |
| A0A146HXJ5 | 195-280 | None |
| A0A452TPJ1 | 216-324 | None |
| A0A834MZW3 | 21-94 | None |
| K8EMB8 | 63-183 | None |
| A0A1D2MVQ3 | 128-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.