DPCstruct | MC407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 174 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1TE38 | 164-319 | SHFFDNVELSLRAWHSPYSNKHSPSLPFSIAGRTFRLAIAASREHWFVVMHPKPGITARNSTDRQLKTRATAMASHHAEAMASYIHD… |
| A0A0D2CE41 | 1-190 | MKPITHASDRFFDNGTLSFRNWRSSHSCKHIHGFAFDLQRRTFGLATAATRESWFIVFHPAGTRIHELPPSRRAQRQEVEEASRSSA… |
| A0A420N2H2 | 1-169 | None |
| G4MXW7 | 134-305 | None |
| A0A0B4GIZ6 | 142-325 | None |
| A0A164Z7J4 | 50-211 | None |
| X0LZ41 | 69-229 | None |
| A0A0B4G6C0 | 145-309 | None |
| W9Z1P0 | 1-169 | None |
| A0A0N0DBM9 | 378-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.