DPCstruct | MC40697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0DEC3 | 1-90 | MQLDDQKRVRKNGGARSALAPEGFVILSGTYHQKIAVELGVPVPSPKEYISVRVVPSDDDNGPLIDNIHWRRALPDEASTVTAPTTI… |
| A0A4U8VYW1 | 160-236 | ARHHLRADGIVLLGHQNDGPKIASQLGLPKIAKGTYIAVRLAEVTGPTDERPAALIGGRYYAIATPSDPKLPAPSIK |
| A0A4Q8CVK4 | 529-605 | None |
| A0A372ZR54 | 204-281 | None |
| A0A1C4LQM5 | 1-83 | None |
| A0A6B2T0F4 | 960-1047 | None |
| A0A7W9YJU6 | 252-326 | None |
| A0A839RH67 | 256-348 | None |
| A0A4Y3RXK4 | 435-511 | None |
| A0A6B0ZD64 | 68-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.