DPCstruct | MC40695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536QUV5 | 450-519 | KDTIEETPPELVADVMDQGIYLAGGGALLRGLDTRVAEATQMAVHIADDPLTCVARGCGKILEELENYER |
| A0A7X2SRP7 | 11-69 | VAADVIDHGIVLTGGGALLKHLPEVISEATKVPVFVASEPLDCVAIGTGESLKSIEVMK |
| A0A832KKL9 | 32-98 | None |
| A0A6L5C4J4 | 210-283 | None |
| A0A7C5KSW0 | 30-98 | None |
| A0A2G2J2B1 | 347-434 | None |
| A0A3L7W9S5 | 375-448 | None |
| A0A645JDX1 | 2-48 | None |
| A0A7W1Q5X7 | 25-91 | None |
| A0A7C2QNS1 | 68-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.