DPCstruct | MC40694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2MFN8 | 22-140 | ELLNVSAEKDRQKIFNAFQVEFGRDLSPIELETINDWIEEDKYKTDLILLALREAVLSQAYSLKYIDRILLSWEKQGIRSKVDVENL… |
| A0A3D1PJS7 | 1-91 | MQKIIDFYNENIGLITPYGVEVLEDYSKDMPTDLIIYAMQISVEANKRTIKYIKAILNNWQKAGIRTLVQAKDENHKKKNESKEIEE… |
| A0A844JZB5 | 38-134 | None |
| A0A359YI39 | 77-188 | None |
| A0A4V3V742 | 1-142 | None |
| G2IFG7 | 185-322 | None |
| A0A847NF81 | 1-142 | None |
| A0A4V3X8S0 | 56-158 | None |
| S2YJ14 | 123-225 | None |
| U2VHG3 | 20-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.