DPCstruct | MC40692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 172 ± 45 aa |
| Standard deviation of domain lengths | 44.81 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.73 |
| Pfam Score | 85.72 |
| Assigned Pfam label(s) | PF14204- CL0267- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6JYA7 | 250-419 | KLGLDKKYEGVVEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGARVFGAMKGASDGGLYVPHSPSRFPGWDIETEELDDETLRKY… |
| A0A7J3MFX8 | 43-146 | INEAILDIGPQRSTRGNRLYAALKGLIDSGVQIPYDPDILPSAERIVGKHIAEFSRRLKEKDPKRYDRQFSFYLANGIRPEEITNNF… |
| L9KKS6 | 47-213 | None |
| L9JDS6 | 246-378 | None |
| A0A812Q7F2 | 51-221 | None |
| A0A812Q4Z8 | 52-315 | None |
| A0A6A3BB58 | 86-242 | None |
| A0A0A0HYV6 | 312-537 | None |
| A0A7J8LS86 | 1-126 | None |
| A0A317YG83 | 52-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.