DPCstruct | MC40686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2587 |
|---|---|
| Mean domain length (aa) | 226 ± 46 aa |
| Standard deviation of domain lengths | 46.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.81 |
| Pfam Score | 79.42 |
| Assigned Pfam label(s) | PF01594- CL0020- CL0398- CL0263- CL0396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5NSJ2 | 8-246 | GSGSQGNAAVIGFGQRRFLLDAGLSCRRIVQGLEALGITLDDLNGLFITHDHEDHVKGLRVLLGKREELPIFATRGTLAAIERKGLE… |
| A0A6B7PW49 | 207-432 | YPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDR… |
| A9WVD1 | 30-201 | None |
| A0A0D8XEE0 | 22-242 | None |
| A0A7G7JKC1 | 278-534 | None |
| A0A0G4HCE0 | 17-225 | None |
| M1UXY6 | 302-574 | None |
| A0A7C0ZNP2 | 1-207 | None |
| A0A7C2CWV6 | 7-156 | None |
| A0A0P7GPV6 | 21-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.