DPCstruct | MC40680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 280 ± 38 aa |
| Standard deviation of domain lengths | 37.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S6XA57 | 53-357 | TAPLTVRNELTKAIPMIWRCIFRALEPTRIVIHANHSDLLLVIGRVLTPFGEPTIPSLEDLHILELDRKQSSVVADSADHDSTDYGL… |
| A0A177C6X7 | 99-370 | RHVSTADAPLAHAVREIWDQVFSNLDPNRVVVAAPPSTLSALLDSQMLSSDAWAFDMKMHYVEFLQQDPQRAAHRNPECRPWGNALV… |
| A0A370TUA2 | 501-737 | None |
| A0A6A5WYS9 | 178-467 | None |
| A0A1L9VNM6 | 1-308 | None |
| A0A4S9CNT0 | 35-342 | None |
| A0A395ILL2 | 15-264 | None |
| A0A2P7YIX7 | 67-305 | None |
| A0A086T9B3 | 95-395 | None |
| C4JKV7 | 220-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.