DPCstruct | MC4068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815K8H2 | 111-212 | IYNNINLTRIRAKNVGDYGRQVLRKIFSDEELISSILPPEGQQYARKPLDVEKFEFLHNALRSKYHIAADRYDEFYNKLIRLKLAEF… |
| A0A820YCD5 | 30-122 | DHNGTNLVTIVGRDVGDFAREVMRVLYSEEERKTHILPPGRSHLSRKPLDSNRFALLNDAVRVKYRLSKHLYDDFFKYHLRPKLSDF… |
| A0A815IUW2 | 22-113 | None |
| A0A7M6DLX1 | 21-150 | None |
| A0A815TJZ5 | 278-368 | None |
| A0A815WXR6 | 1-94 | None |
| A0A815S1H1 | 324-411 | None |
| A0A815SEB9 | 262-355 | None |
| A0A815FQ83 | 1-92 | None |
| A0A6P8IS70 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.