DPCstruct | MC40679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 155 ± 34 aa |
| Standard deviation of domain lengths | 34.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S6X9S7 | 10-157 | LVSTSGESSVIVSQFRQRAERGYGITCSGCKETKSEKAFSNAQKDAFVENKGDFAILCLTCNGTKKFEIQCSTCDRVLGLNKFAKSQ… |
| A0A391NVT6 | 57-148 | VPVKAPPATPHLQCAQCGHRKPSGSFSKGQRSKGRDRKCRVCTKANVRAIASATLECSLCHVPKTRDSYTKTQRSRGGGRVCVECRR… |
| A0A1J9R3E1 | 23-133 | None |
| A0A3N4LYX9 | 3-185 | None |
| A0A0G2FJL0 | 1-180 | None |
| A0A0F4YPH3 | 17-185 | None |
| A0A2U3DTC8 | 228-354 | None |
| A0A0E9NQK2 | 60-195 | None |
| A0A077WSR7 | 4-137 | None |
| O94276 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.