DPCstruct | MC40676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 386 ± 66 aa |
| Standard deviation of domain lengths | 66.26 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S6X5S3 | 8-452 | KNGKPKTDIEAAASTETAPSTATTAAPLAAPWTATSTGPSSVPVTFPSTVPSSPKASSFADSDRTGKTGRSLFFEELKYEVMCNYIF… |
| A0A4Y8DG37 | 89-401 | GVMVRKDRTEYLCRPPALASSTFGRAMKIMNVSAAMTINSTVVQPFLTRSPDALDVPLTNGLRVQILPTLEDLPRARRAHYAAFIAR… |
| A0A163FIR5 | 262-703 | None |
| A0A179F2Y4 | 1-500 | None |
| A0A4S9C599 | 1-441 | None |
| A0A0E9NQB9 | 34-495 | None |
| M2Q872 | 31-378 | None |
| A0A395J675 | 1-322 | None |
| A0A0G4MKN0 | 136-585 | None |
| A0A139HB84 | 8-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.