DPCstruct | MC40671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835GUH9 | 1-104 | CVEKECIDWEGKSVPHGLLYVPGPGVCSLCVCYHSEPMWCKAIYCDPPYFCKNFRVGARCCEFECLDPPGEDVRYRERERLRALILS… |
| A0A7E5VH06 | 11-139 | LLTATLALLAALVACVEEECVDWEGKSVPHGLLYVPGPGVCSLCVCYHSEPKWCKAIYCDPPYFCKKFRVGERCCEFECLDPPGEDT… |
| E9GKW7 | 11-120 | None |
| A0A8B6CSK6 | 4-137 | None |
| A0A6P8N9J3 | 31-139 | None |
| A0A6P8MLC7 | 1-105 | None |
| A0A484AXN2 | 6-110 | None |
| T2MEA6 | 16-140 | None |
| A0A7E4RLD6 | 1-113 | None |
| A0A5E4Q1D2 | 7-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.