DPCstruct | MC4067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 155 ± 39 aa |
| Standard deviation of domain lengths | 39.05 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5A7A3 | 133-267 | QLQGRGVNDEEHLGLLILDFFELYGCHFRHESNAISLKGTVGYVPKSSVSTFTYKNTNRLSIIDPNNPANDIAGGSSNTAAILDRFY… |
| A0A820XZ95 | 3-138 | GHMLISFLELYGVYFNYAKLGIRVQTPNQSDRSAGFIDKEELFKNFCCGHRTISNLCIVDPFNDKNDISKASWLTPKLNSAFREAFD… |
| A0A7S2RIZ8 | 46-147 | None |
| A0A5N5TNU9 | 176-356 | None |
| E0CSL1 | 282-494 | None |
| A0A084R7H3 | 755-923 | None |
| A0A7R9KQV4 | 1046-1211 | None |
| A0A7R9UDS4 | 213-327 | None |
| S4RRL6 | 51-191 | None |
| A0A6V7U2N5 | 32-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.