DPCstruct | MC40668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0SCG9 | 1-142 | MVEERFSFRDAHDIERALHGARSRRNMFYRSPKGALPFSVHPDRRYSIGDFCCHDGVVFVTAAYQGLLERQPDAEGAAYFLALRESG… |
| A0A2W4RPZ1 | 447-546 | QPSRVVELQLHPNYNEIKSVDDLLQLEGEFFVEAAYQKILLRKSDPSGLNYYVEKLKNGYSKLNIIKDLRNSSEGRSLVVILSGLED… |
| A0A6G4QZ87 | 1-164 | None |
| J2WJU9 | 1-120 | None |
| A0A060DVB8 | 327-459 | None |
| U2FUL4 | 196-339 | None |
| A0A7C5SPS2 | 14-143 | None |
| F3LNN6 | 37-196 | None |
| A0A3D2VS38 | 37-168 | None |
| A0A4R6YS91 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.