DPCstruct | MC40657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 137 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535ZB73 | 4-123 | EIRLELFETAVSRLLSEGEDRDCVIFELRGRPDCYVQFILHDGALLGEVGSRGWAPEGELLDRERITALGCLGFEGGGHRANFARDH… |
| A0A7D6Z1B4 | 39-167 | GAAVTDWGNFTARLTLMLTAMCDSDWIVLEADGGRFARFGVGFSRDILCEIASNDDLDERYRMSSDDEAAMGKLGWKAGKYSWELYL… |
| A0A117N948 | 142-269 | None |
| A0A1M7RCQ1 | 151-309 | None |
| A0A2G2LAH6 | 206-330 | None |
| A0A517Y4K3 | 1-126 | None |
| A0A662V707 | 4-139 | None |
| A0A449GXH5 | 5-133 | None |
| A0A1V5ZME3 | 1-132 | None |
| A0A7K0C4H3 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.