DPCstruct | MC40655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535Z1E9 | 17-151 | RKTYDLIDEPVGADYDALLDCALTQCATFVLAVPRDSGDPAAREVLDELAPHLGSTSDASAVSIHRYTLNRESVATLKAAARGLYAW… |
| A0A1M6R8X7 | 3-110 | YIEFDVTERNNLRWKEMMYKKLKTAKTFEIHCWNMEQEEINMALLFGEVKETCWKYGKIIQGNVTPEFTNYVLNIPKPADTEIYNKM… |
| A0A4R6L677 | 12-176 | None |
| A0A4C2EFY5 | 36-184 | None |
| A0A6B2TUQ9 | 1-136 | None |
| A0A3B0BFT8 | 7-143 | None |
| A0A3A8ZKC3 | 1-160 | None |
| A0A1Q4X0U2 | 43-199 | None |
| A0A1Y4LKU0 | 19-172 | None |
| A0A841A9W3 | 25-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.