DPCstruct | MC4065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.29 |
| Pfam Score | 81.32 |
| Assigned Pfam label(s) | CL0266- PF02212 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1IKP0 | 1-66 | MLPLDGLRLRDIEQEFMSRRHTFALFNQEGRNIYTDYIQLELSCENTDEVDSWKASFLRAGVYPGK |
| A0A820WBU1 | 3-93 | PLENLKIRDVEGGFMAKRPQFAIFNIDSKNVFKEHKTLELSVDNTDELDTWKASFLRAGVYPEREQPSEDTQTTAEVGPIDPHMERQ… |
| A0A4W5Q972 | 48-122 | None |
| A0A183E017 | 183-249 | None |
| A0A183EH08 | 1-76 | None |
| A0A091DN37 | 636-713 | None |
| A0A183LHN4 | 5-94 | None |
| A0A183RNW7 | 7-75 | None |
| A0A3B4V5X7 | 722-787 | None |
| A0A821LNP6 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.