DPCstruct | MC40641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817RAZ0 | 2-95 | QNLQYNPWLIHLMAHLLASDQYSPVNVVLSIGGNPFPDAPPRFIKADLYRYKFTRIGSEDKNWWIRSNQQPYSPIFELKSPQLKSIL… |
| A0A6P9BYR1 | 69-169 | RLDWLMWFAAFQTYEQNEWVIHLAGKLLANEKETLSLLAFNPFVDKAPPKWVRGEHFRYKFSRPGGQHARQQKWWIRKRLGPYFPPV… |
| F1L4I2 | 246-365 | None |
| A0A2N9NLP7 | 108-186 | None |
| C4WWZ8 | 3-82 | None |
| A0A401RBI2 | 99-183 | None |
| A0A1V9Z5D0 | 752-887 | None |
| A0A183NDX4 | 332-433 | None |
| A0A3T1C9P2 | 55-131 | None |
| A0A7C5N7E2 | 4-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.