DPCstruct | MC4064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0552- PF21772- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819FDE2 | 19-176 | ISLGCLPSLSTYALLPFGQKAFYYWSILIPTAYPFSLLLSICWRSVSTHLIVLQSIFNWLLATFIFIIAGQSPCPWLADTMQGALMI… |
| A0A820VJW7 | 2-159 | FVFGCLPTLVTYSILPYGQKTLYYCNILFPISYSLAALYGFIRPTISTFWIIMNSICGCLICAFIIVVAFQSPCPIWADTLHGGIII… |
| A0A815TQ28 | 2-136 | None |
| A0A814H418 | 104-259 | None |
| A0A7J5ZSX4 | 802-961 | None |
| A0A498M5E2 | 280-453 | None |
| A0A821RAT6 | 824-992 | None |
| A0A5F4VVS0 | 517-688 | None |
| A0A815GZ65 | 267-429 | None |
| A0A1B0DG58 | 280-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.