DPCstruct | MC40635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 782 ± 96 aa |
| Standard deviation of domain lengths | 96.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815NSQ8 | 123-911 | IDEFSHQYPTPCPYTPFHCSLYDDLTEHRNSRGLSNAVHQHCLNFAHVCRAGRNCTDTTQLHWSRSFHIARNLCPYGEKCLRLTDEE… |
| A0A817Q684 | 73-912 | VCPKDGKCKQLTDENHLNSFTHSNIDDVRLPCKYDDRCYYRRQPDHVTKYRHAVTFEYGGILRYYNLNKDIDFVENQKNIIARVTDY… |
| A0A816LVL3 | 3-591 | None |
| A0A815L246 | 1-827 | None |
| A0A815QY10 | 9-747 | None |
| A0A816EPK9 | 1-722 | None |
| A0A815T1B3 | 117-1035 | None |
| A0A812M6G8 | 123-879 | None |
| A0A815JW36 | 5-559 | None |
| A0A815BY63 | 198-1153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.