DPCstruct | MC4063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820V641 | 1-114 | MPKKLVTSVKINNTRGCIRCCVGRNQFNGFIYLAGMLTNEVFLMQYYDPLRKFMHLKTVSISIPAEPSIFEMIFSPENQYAIVCIGV… |
| A0A5B7FIH2 | 2-109 | FCCPFFQVPDTKGTLRCCVGRNPYNGYKYLCGATTSALYLMQWYDPLNKFMLLKQSECYLPHPLRVFEMVITPDLEYPLMCVDVNRS… |
| A0A673Z035 | 389-496 | None |
| A0A085LVJ4 | 434-554 | None |
| A0A3Q3AQT6 | 442-550 | None |
| A0A4W4FU79 | 265-392 | None |
| A0A6P7GSB4 | 3-117 | None |
| A0A556TMR8 | 337-463 | None |
| A0A3B4Y6L1 | 38-152 | None |
| A0A3N0Z8N4 | 388-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.