DPCstruct | MC40627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 391 ± 41 aa |
| Standard deviation of domain lengths | 41.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TQ51 | 34-377 | VIQFLLYECAALGDVFFVVITAMSCWITFAYKTQKYPFYTTLNEDQEWVLMAYLIATLCLKFVALIHTILQMVLQEIFFIDWERPHV… |
| A0A816WKB6 | 1-339 | MNLEIYTPSVLIALGVVSGLAVIVGLIQTCAWYSRTGKEIIDLPIQYNGTFESNISTPQSTFKMLLIVSFILKTVDILHLIIRQSRI… |
| A2FR54 | 363-757 | None |
| T1KY17 | 560-1036 | None |
| A0A2P6MXG7 | 482-900 | None |
| A0A3M7RZI8 | 415-801 | None |
| A0A4P9X313 | 5-376 | None |
| A9V7K2 | 72-444 | None |
| A0A2A6B719 | 608-1043 | None |
| A0A6H5I284 | 14-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.