DPCstruct | MC40617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8FNV5 | 28-159 | TPDSLPSDNDVLDLIRKFGRKYDRSENEIRKACDLAAGHSDLVVILERPARTHNYSLGFKEFVANCRTLDALDKFIKFATNKTRSIE… |
| A0A0D2YIU3 | 102-252 | MLCLDIPVPRCVQKLIFEPPVCLLNVQDIKAVNLIRKFGDEFGRRRDEIDQACSLASGPSDVVILLERPHESQTYHGTFGEFVKRCK… |
| A0A395H5Z3 | 11-165 | None |
| A0A2V1B6Y0 | 1-158 | None |
| A1DKG9 | 7-148 | None |
| A0A1E3BLZ6 | 169-312 | None |
| A0A2J6QP38 | 71-250 | None |
| A0A6A6JQT6 | 9-162 | None |
| A0A1L9TEX0 | 1-122 | None |
| A0A2J6T639 | 75-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.