DPCstruct | MC40614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 439 ± 83 aa |
| Standard deviation of domain lengths | 83.21 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8KSH8 | 1-291 | MYQYVRNNIEYYPVFGSQKGALGSVLDNQATAHDQATLMVELLRASGFEANYVRGIAKLSAAQLAEWWGVSTANACGVLSLLGQAQI… |
| A0A290ZLW0 | 1-471 | MRRLPLTSLIAAVLCAGLAHAAPPKELAPLPAEALQAVKAAQHRAGDRLADTLGRHLSEARALARRADAATDDDLATRRSEAAAKRQ… |
| A0A2D2DT53 | 1-512 | None |
| A4XG91 | 24-575 | None |
| A0A6P2SVQ6 | 14-458 | None |
| A0A0F6A5V1 | 37-446 | None |
| A0A1E7ZGF4 | 268-624 | None |
| A0A2N9XTG1 | 126-660 | None |
| A0A4E0QVX8 | 112-493 | None |
| G8LY29 | 1-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.