DPCstruct | MC40611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 140 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1I7J3 | 15-141 | ENGSGGWLSDSTFVGGMFGAYFGNQQFTSRNLAFYGCKTALQISWDWAWTMQGINIKNCGSGIDVVGEAGGSLGTSKNVRSLTLLYL… |
| A8Q103 | 1-138 | MENASGGFMSDLTFHGGRFGAWMGNQQFTVRNVYFSECKTAICMHWNWAWTFIDVHVHNCEIGLELLGMFPDKQGVGSLILSDWDVS… |
| A0A2S4L0D2 | 429-548 | None |
| A0A1Z5SVZ4 | 4-144 | None |
| J3PE45 | 202-343 | None |
| U7PQ26 | 723-861 | None |
| U7Q190 | 374-514 | None |
| A0A0C9UMK5 | 224-365 | None |
| A0A2P6MUI7 | 571-712 | None |
| A0A194X730 | 163-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.