DPCstruct | MC4061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1467 |
|---|---|
| Mean domain length (aa) | 171 ± 37 aa |
| Standard deviation of domain lengths | 36.97 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.39 |
| Pfam Score | 89.42 |
| Assigned Pfam label(s) | CL0020- PF02887- PF05406- CL0511- PF12174 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820STH4 | 16-157 | RNPGLDDVYHSMKNLISGQCVNSNANELYLFHGTSADNVESIMEMGFDDRYFSSDGLYGHGAYFADNPLKSHQYTKKSEVDRTCKMF… |
| A0A1X9YZ90 | 2-142 | IVFRLAKEEFKTDLLGTGGLYGPGRWHETGTRLLYTAESFSLAKLEVLANSSMLPKNMALVIIEIPDDISLKELTEEDLPDNWADFP… |
| A9JRH9 | 537-713 | None |
| A0A819RQ36 | 48-214 | None |
| A0A822DDQ0 | 1-80 | None |
| F2VQY1 | 3-127 | None |
| A0A6S7FX79 | 366-559 | None |
| F6H0J0 | 133-305 | None |
| A0A061RI72 | 539-741 | None |
| A0A822DGW4 | 104-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.